Products

GM-CSF (Granulocyte-macrophage colony-stimulating factor), Swine

Granulocyte-macrophage colony-stimulating factor (GM-CSF), also known as colony-stimulating factor 2 (CSF2), is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, natural killer cells, endothelial cells and fibroblasts that functions as a cytokine. GM-CSF also plays a role in embryonic development by functioning as an embryokine produced by reproductive tract.
No. Size Price Qty Status
C03018-5UG 5 ug $120.00 Inquiry
C03018-20UG 20 ug $300.00 Inquiry
C03018-100UG 100 ug $594.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
APTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTE
ETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK with polyhistidine tag at the N-terminus

UnitProt ID:
Q29118
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <3 ng/mL.
 
Purity:
>98% as determined by SDS-PAGE analysis.

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage​:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping conditions:
Blue ice
Reviews for GM-CSF (Granulocyte-macrophage colony-stimulating factor), Swine

Average Rating: 0 (0 Reviews )